Cerebral cavernous malformations 2 protein
Annotation score:5 out of 5
The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.
– Experimental evidence at protein level i
This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.
Select a section on the left to see content.
This section provides any useful information about the protein, mostly biological knowledge.
The Gene Ontology (GO) project provides a set of hierarchical controlled vocabulary split into 3 categories:
GO – Biological process i
- blood vessel endothelial cell differentiation Source: Ensembl
- cell-cell junction organization Source: Ensembl
- endothelial cell development Source: Ensembl
- endothelial tube morphogenesis Source: MGI
Inferred from Mutant Phenotype
Describes annotations that are concluded from looking at variations or changes in a gene product such as mutations or abnormal levels and includes techniques such as knockouts, overexpression, anti-sense experiments and use of specific protein inhibitors.
More information in the GO evidence code guide
Inferred from mutant phenotype i
Traceable Author Statement
Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.
More information in the GO evidence code guide
Traceable author statement i
UniProtKB Keywords constitute a controlled vocabulary with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.
Molecular function | Developmental protein |
This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.
Names & Taxonomy i
This subsection of the Names and taxonomy section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.
Protein names i
Manually curated information that is based on statements in scientific articles for which there is no experimental support.
Manual assertion based on opinion in i
This subsection of the Names and taxonomy section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.
Gene names i
This subsection of the Names and taxonomy section provides information on the name(s) of the organism that is the source of the protein sequence.
Organism i
This subsection of the Names and taxonomy section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.
Taxonomic identifier i
This subsection of the Names and taxonomy section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.
Taxonomic lineage i
This subsection of the Names and taxonomy section is present for entries that are part of a proteome, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.
Proteomes i
-
UP000005640
A UniProt proteome can consist of several components.
The component name refers to the genomic component encoding a set of proteins.
Component i : Chromosome 7
Organism-specific databases
Human Gene Nomenclature Database
More. HGNC i
Online Mendelian Inheritance in Man (OMIM)
More. MIM i
neXtProt; the human protein knowledge platform
More. neXtProt i
This section provides information on the location and the topology of the mature protein in the cell.
Subcellular location i
Extracellular region or secreted
Automatic computational assertion
Graphics by Christian Stolte & Seán O’Donoghue; Source:
Other locations
- Cytoplasm By similarity
Mitochondrion
- mitochondrion Source: HPA
Other locations
- cytoplasm Source: UniProtKB
Inferred from Direct Assay
Used to indicate a direct assay for the function, process or component indicated by the GO term.
More information in the GO evidence code guide
Inferred from direct assay i
Keywords – Cellular component i
This section provides information on the disease(s) and phenotype(s) associated with a protein.
Pathology & Biotech i
This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the OMIM database are represented with a controlled vocabulary in the following way:
Involvement in disease i
Cerebral cavernous malformations 2 (CCM2) 3 Publications
Manually curated information for which there is published experimental evidence.
Manual assertion based on experiment in i
Related information in OMIM
Feature key | Position(s) | Description Actions | Graphical view | Length |
---|---|---|---|---|
This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence. Natural variant i VAR_023577 |
198 | L → R in CCM2. 1 Publication
Manual assertion based on experiment in i Corresponds to variant dbSNP:rs137852843Ensembl . |
1 | |
Natural variant i VAR_067352 | 215 | Q → H in CCM2; associated with Q-229. 1 Publication
Manual assertion based on experiment in i |
1 | |
Natural variant i VAR_067353 | 229 | L → Q in CCM2; associated with H-215. 1 Publication
Manual assertion based on experiment in i Keywords – Disease iOrganism-specific databasesMore. DisGeNET i |
83605 | |
CCM2 | ||||
CCM2 | ||||
MIM i | 603284 phenotype | |||
ENSG00000136280 | ||||
221061 Familial cerebral cavernous malformation | ||||
PA26145 |
Miscellaneous databases
Pharos NIH Druggable Genome Knowledgebase
More. Pharos i
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database
More. BioMuta i
Domain mapping of disease mutations (DMDM)
More. DMDM i
This section describes post-translational modifications (PTMs) and/or processing events.
PTM / Processing i
Molecule processing
Feature key | Position(s) | Description Actions | Graphical view | Length |
---|---|---|---|---|
1 – 444 | Cerebral cavernous malformations 2 protein Add BLAST | 444 |
Amino acid modifications
Feature key | Position(s) | Description Actions | Graphical view | Length |
---|---|---|---|---|
15 | Phosphoserine Combined sources
Manually validated information inferred from a combination of experimental and computational evidence. Manual assertion inferred from combination of experimental and computational evidence i |
1 | ||
Modified residue i | 164 | Phosphoserine Combined sources
Manual assertion inferred from combination of experimental and computational evidence i |
1 | |
Modified residue i | 384 | Phosphoserine By similarity
Manually curated information which has been propagated from a related experimentally characterized protein. Manual assertion inferred from sequence similarity to i
|
1 | |
Modified residue i | 393 | Phosphoserine By similarity
Manual assertion inferred from sequence similarity to i
|
1 | |
Modified residue i | 394 | Phosphothreonine By similarity
Manual assertion inferred from sequence similarity to i
|
1 | |
Modified residue i | 396 | Phosphoserine By similarity
Manual assertion inferred from sequence similarity to i
|
1 | |
Modified residue i | 399 | Phosphothreonine By similarity
Manual assertion inferred from sequence similarity to i Keywords – PTM iProteomic databasesEncyclopedia of Proteome Dynamics More. EPD i |
Q9BSQ5 | |
Q9BSQ5 | ||||
Q9BSQ5 | ||||
Q9BSQ5 | ||||
Q9BSQ5 | ||||
Q9BSQ5 | ||||
Q9BSQ5 | ||||
19677 25314 26772 78919 [Q9BSQ5-1] 78920 [Q9BSQ5-2] |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context
More. iPTMnet i
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.
More. PhosphoSitePlus i
This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.
Gene expression databases
Bgee dataBase for Gene Expression Evolution
More. Bgee i
ExpressionAtlas, Differential and Baseline Expression
More. ExpressionAtlas i
Genevisible search portal to normalized and curated expression data from Genevestigator
More. Genevisible i
Organism-specific databases
Human Protein Atlas
More. HPA i
This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.
This subsection of the ‘Interaction’ section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the ‘Function’ section).
Subunit structure i
Part of a complex with MAP2K3, MAP3K3 and RAC1. Binds RAC1 directly and independently of its nucleotide-bound state (By similarity).
Interacts with HEG1 and KRIT1; KRIT1 greatly facilitates the interaction with HEG1 (By similarity).
Interacts with PDCD10.
By similarity 2 Publications
Manual assertion based on experiment in i
This subsection of the ‘Interaction section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the IntAct database. It is updated at every UniProt release.
Binary interactions i
Q9BSQ5
With | #Exp. | IntAct |
---|---|---|
DOK4 [Q8TEW6] | 3 | EBI-1573056,EBI-6918542 |
HOXC8 [P31273] | 3 | EBI-1573056,EBI-1752118 |
KRIT1 [O00522] | 15 | EBI-1573056,EBI-1573121 |
PDCD10 [Q9BUL8] | 5 | EBI-1573056,EBI-740195 |
RIN1 [Q13671] | 3 | EBI-1573056,EBI-366017 |
TLNRD1 [Q9H1K6] | 3 | EBI-1573056,EBI-12344941 |
TWIST2 [Q8WVJ9] | 3 | EBI-1573056,EBI-1797313 |
VSTM2L [Q96N03] | 3 | EBI-1573056,EBI-948213 |
Isoform 1 [Q9BSQ5-1]
With | #Exp. | IntAct |
---|---|---|
KRIT1 [O00522] | 2 | EBI-16157769,EBI-1573121 |
MAP3K3 [Q99759] | 6 | EBI-16157769,EBI-307281 |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid)
More. BioGrid i
ComplexPortal: manually curated resource of macromolecular complexes
More. ComplexPortal i
CORUM comprehensive resource of mammalian protein complexes
More. CORUM i
Database of interacting proteins
More. DIP i
Protein interaction database and analysis system
More. IntAct i
Molecular INTeraction database
More. MINT i
STRING: functional protein association networks
More. STRING i
Miscellaneous databases
RNAct, Protein-RNA interaction predictions for model organisms.
More. RNAct i
This section provides information on the tertiary and secondary structure of a protein.
Secondary structure
Show more detailsHide details
This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.
Family & Domains i
Domains and Repeats
Feature key | Position(s) | Description Actions | Graphical view | Length | ||||||
---|---|---|---|---|---|---|---|---|---|---|
59 – 248 | PID PROSITE-ProRule annotation
Manual validated information which has been generated by the UniProtKB automatic annotation system. Manual assertion according to rules i Region
This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection. Manual assertion based on experiment in i This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins. Sequence similarities i Phylogenomic databasesevolutionary genealogy of genes: Non-supervised Orthologous Groups More. eggNOG i |
ENOG410IHRT Eukaryota ENOG410ZBNR LUCA |
||||||||
ENSGT00390000016168 | ||||||||||
Q9BSQ5 | ||||||||||
SFPECAH | ||||||||||
1446057at2759 | ||||||||||
Q9BSQ5 | ||||||||||
TF328517 |
Family and domain databases
Conserved Domains Database
More. CDD i
Integrated resource of protein families, domains and functional sites
More. InterPro i
IPR032375 CCM2_C
IPR026159 Malcavernin
IPR006020 PTB/PI_dom
The PANTHER Classification System
More. PANTHER i
Pfam protein domain database
More. Pfam i
PF16545 CCM2_C, 1 hit
PROSITE; a protein domain and family database
More. PROSITE i
PS01179 PID, 1 hit
This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including length and molecular weight. The information is filed in different subsections. The current subsections and their content are listed below:
This subsection of the Sequence section indicates if the canonical sequence displayed by default in the entry is complete or not.
Sequence status i : Complete.
This entry describes 4
This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.
isoforms i produced by alternative splicing . AlignAdd to basketAdded to basket
This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All
This isoform has been chosen as the
What is the canonical sequence?
canonical i sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.
It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.
However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).
The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x 64 + x 4 + x 3 + x + 1. The algorithm is described in the ISO 3309 standard.
Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.
Cyclic redundancy and other checksums
Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993))
Checksum: i 43F9C153B4DE460E
The sequence of this isoform differs from the canonical sequence as follows:
1-10: MEEEGKKGKK → MHSSCRQRRNQNLSKEIPQTEFHTGYSMENE
The sequence of this isoform differs from the canonical sequence as follows:
158-248: Missing.
The sequence of this isoform differs from the canonical sequence as follows:
11-68: Missing.
In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.
Computationally mapped potential isoform sequences i
There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
Entry | Entry name | Protein names | Gene names | Length | Annotation | |||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
C9JUH3 | C9JUH3_HUMAN | 347 | Annotation score:
Annotation score:1 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein. | |||||||||||||||||||||||||
A0A0A0MT72 | A0A0A0MT72_HUMAN | 438 | Annotation score:
Annotation score:1 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein. | |||||||||||||||||||||||||
E9PEC4 | E9PEC4_HUMAN | 271 | Annotation score:
Annotation score:1 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein. | |||||||||||||||||||||||||
A0A3B3IRS0 | A0A3B3IRS0_HUMAN | 256 | Annotation score:
Annotation score:1 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein. | |||||||||||||||||||||||||
H7C516 | H7C516_HUMAN | 135 | Annotation score:
Annotation score:1 out of 5 The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score cannot be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein. Experimental Info
Natural variant
Manual assertion based on experiment in i Corresponds to variant dbSNP:rs2107732Ensembl . |
1 | ||||||||||||||||||||||||
Natural variant i VAR_023576 | 120 | V → I 1 Publication
Manual assertion based on experiment in i Corresponds to variant dbSNP:rs11552377Ensembl . |
1 | |||||||||||||||||||||||||
Natural variant i VAR_023577 | 198 | L → R in CCM2. 1 Publication
Manual assertion based on experiment in i Corresponds to variant dbSNP:rs137852843Ensembl . |
1 | |||||||||||||||||||||||||
Natural variant i VAR_067352 | 215 | Q → H in CCM2; associated with Q-229. 1 Publication
Manual assertion based on experiment in i |
1 | |||||||||||||||||||||||||
Natural variant i VAR_067353 | 229 | L → Q in CCM2; associated with H-215. 1 Publication
Manual assertion based on experiment in i |
1 | |||||||||||||||||||||||||
Natural variant i VAR_050768 | 289 | S → N. Corresponds to variant dbSNP:rs2289366Ensembl . | 1 |
Alternative sequence
Feature key | Position(s) | Description Actions | Graphical view | Length |
---|---|---|---|---|
1 – 10 | MEEEGKKGKK → MHSSCRQRRNQNLSKEIPQT EFHTGYSMENE in isoform 2. 1 Publication
Manual assertion based on opinion in i |
10 | ||
Alternative sequence i VSP_046695 | 11 – 68 | Missing in isoform 4. Curated AddBLAST | 58 | |
Alternative sequence i VSP_046696 | 158 – 248 | Missing in isoform 3. Curated AddBLAST | 91 |
Sequence databases
Select the link destinations: |
EMBL nucleotide sequence database
GenBank nucleotide sequence database
DNA Data Bank of Japan; a nucleotide sequence database
AF370392 mRNA Translation: AAQ15228.1
AC004847 Genomic DNA No translation available.
AC013416 Genomic DNA No translation available.
CH236960 Genomic DNA Translation: EAL23746.1
CH471128 Genomic DNA Translation: EAW61061.1
CH471128 Genomic DNA Translation: EAW61064.1
BC004903 mRNA Translation: AAH04903.1
BC008859 mRNA Translation: AAH08859.1
BC016832 mRNA Translation: AAH16832.1
BC025958 mRNA Translation: AAH25958.1
The Consensus CDS (CCDS) project
More. CCDS i
CCDS5500.1 [Q9BSQ5-1]
CCDS55108.1 [Q9BSQ5-3]
CCDS55109.1 [Q9BSQ5-4]
NCBI Reference Sequences
More. RefSeq i
NP_001161406.1, NM_001167934.1 [Q9BSQ5-4]
NP_001161407.1, NM_001167935.1 [Q9BSQ5-3]
NP_113631.1, NM_031443.3 [Q9BSQ5-1]
Genome annotation databases
Ensembl eukaryotic genome annotation project
More. Ensembl i
ENST00000381112; ENSP00000370503; ENSG00000136280 [Q9BSQ5-2]
ENST00000541586; ENSP00000444725; ENSG00000136280 [Q9BSQ5-4]
ENST00000544363; ENSP00000438035; ENSG00000136280 [Q9BSQ5-3]
Database of genes from NCBI RefSeq genomes
More. GeneID i
KEGG: Kyoto Encyclopedia of Genes and Genomes
More. KEGG i
UCSC genome browser
More. UCSC i
Keywords – Coding sequence diversity i
This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (UniRef).
Similar proteins i
Protein | Similar proteins | Species | Score | Length | Source | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Q9BSQ5-2 | Cerebral cavernous malformations 2 protein |
Protein | Similar proteins | Species | Score | Length | Source | |||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Q9BSQ5 | CCM2 scaffold protein | 444 | ||||||||||||||||||||||||||||||
+43 | ||||||||||||||||||||||||||||||||
Q9BSQ5-2 | CCM2 scaffold protein | 466 | ||||||||||||||||||||||||||||||
+31 | ||||||||||||||||||||||||||||||||
Q9BSQ5-3 | Isoform 4 of Cerebral cavernous malformations 2 protein |
3D structure databases
Protein Data Bank Europe Protein Data Bank RCSB Protein Data Bank Japan |
PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum | ||||||||||||||||||||||||
4FQN | X-ray | 1.90 | A/B/C/D | 283-379 | [»] | |||||||||||||||||||||||||||
4TVQ | X-ray | 2.80 | E | 224-239 | [»] | |||||||||||||||||||||||||||
4WJ7 | X-ray | 2.75 | A/B/C/D | 51-228 | [»] | |||||||||||||||||||||||||||
4Y5O | X-ray | 2.35 | A | 283-379 | [»] | |||||||||||||||||||||||||||
4YKC | X-ray | 2.70 | A | 290-444 | [»] | |||||||||||||||||||||||||||
4YKD | X-ray | 1.93 | A | 290-376 | [»] | |||||||||||||||||||||||||||
4YL6 | X-ray | 2.10 | A | 290-376 | [»] | |||||||||||||||||||||||||||
SMR i | Q9BSQ5 | |||||||||||||||||||||||||||||||
ModBase i | Search. | |||||||||||||||||||||||||||||||
PDBe-KB i | Search. |
Protein-protein interaction databases
BioGrid i | 123696, 15 interactors |
ComplexPortal i | CPX-984 CCM complex |
CORUM i | Q9BSQ5 |
DIP i | DIP-40609N |
IntAct i | Q9BSQ5, 18 interactors |
MINT i | Q9BSQ5 |
STRING i | 9606.ENSP00000370503 |
PTM databases
iPTMnet i | Q9BSQ5 |
PhosphoSitePlus i | Q9BSQ5 |
Polymorphism and mutation databases
BioMuta i | CCM2 |
DMDM i | 74733042 |
Proteomic databases
EPD i | Q9BSQ5 |
jPOST i | Q9BSQ5 |
MassIVE i | Q9BSQ5 |
MaxQB i | Q9BSQ5 |
PaxDb i | Q9BSQ5 |
PeptideAtlas i | Q9BSQ5 |
PRIDE i | Q9BSQ5 |
ProteomicsDB i | 19677 25314 26772 78919 [Q9BSQ5-1] 78920 [Q9BSQ5-2] |
Protocols and materials databases
Antibodypedia a portal for validated antibodies
More. Antibodypedia i
The DNASU plasmid repository
More. DNASU i
Genome annotation databases
Ensembl i | ENST00000258781; ENSP00000258781; ENSG00000136280 [Q9BSQ5-1] ENST00000381112; ENSP00000370503; ENSG00000136280 [Q9BSQ5-2] ENST00000541586; ENSP00000444725; ENSG00000136280 [Q9BSQ5-4] ENST00000544363; ENSP00000438035; ENSG00000136280 [Q9BSQ5-3] |
GeneID i | 83605 |
KEGG i | hsa:83605 |
UCSC i | uc003tmo.4 human [Q9BSQ5-1] |
Organism-specific databases
Comparative Toxicogenomics Database
More. CTD i
GeneCards: human genes, protein and diseases
More. GeneCards i
607929 gene
GenAtlas: human gene database
More. GenAtlas i
Phylogenomic databases
eggNOG i | ENOG410IHRT Eukaryota ENOG410ZBNR LUCA |
GeneTree i | ENSGT00390000016168 |
InParanoid i | Q9BSQ5 |
OMA i | SFPECAH |
OrthoDB i | 1446057at2759 |
PhylomeDB i | Q9BSQ5 |
TreeFam i | TF328517 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data
More. ChiTaRS i
The Gene Wiki collection of pages on human genes and proteins
More. GeneWiki i
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens
More. GenomeRNAi i
More. PRO i
The Stanford Online Universal Resource for Clones and ESTs
More. SOURCE i
Gene expression databases
Bgee i | ENSG00000136280 Expressed in prefrontal cortex and 193 other tissues |
ExpressionAtlas i | Q9BSQ5 baseline and differential |
Genevisible i | Q9BSQ5 HS |
Family and domain databases
CDD i | cd13516 HHD_CCM2, 1 hit |
InterPro i | View protein in InterPro IPR032375 CCM2_C IPR026159 Malcavernin IPR006020 PTB/PI_dom |
PANTHER i | PTHR21642 PTHR21642, 1 hit |
Pfam i | View protein in Pfam PF16545 CCM2_C, 1 hit |
PROSITE i | View protein in PROSITE PS01179 PID, 1 hit |
Search. | |
Search. |
This section provides general information on the entry.
Entry information i
This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.
Entry name i
This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.
Accession i
Secondary accession number(s): A4D2L4
, B3KUV0, D3DVL4, E9PDJ3, F5H0E1, F5H551, Q71RE5, Q8TAT4
This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the canonical sequence are also displayed.
Entry history i
This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (reviewed) or to the computer-annotated TrEMBL section (unreviewed).
Entry status i
This section contains any relevant information that doesn’t fit in any other defined sections
Сигналы по индикаторам бинарных опционов на валютные пары
Торговля валютными парами на бинарных опционах стала очень популярна у трейдеров во всём мире. Даже те, кто начинал когда-то трейдинг на Форекс вскоре поняли, что на бинарных опционах можно заработать намного больше и в разы быстрее.
Я предлагаю Вам ознакомиться с бесплатными сигналами по валютным парам, используя индикаторы и технический анализ. Они легки в использовании, понятны и доступны. Освоить их сможет даже новичок.
В течение многих лет в трейдинге формировалось направление технического анализа, и это не только чертежи и фигуры. Одаренные математики разрабатывали различные формулы, из которых строились дополнительные графики, получившие название – индикаторы цены. Некоторые из проектов стали очень популярными и заслужили всеобщее признание. Сегодня практически каждый трейдер так или иначе обращает внимание на какие-либо индикаторы. Я в своей торговле столкнулась с ситуацией, что если сигналов слишком много, то график становится переполнен и непонятен. Поэтому, решила обратить внимание на специализированные сервисы и получила более удобный подход к анализу, выраженный в таблице сигналов, основанных на значениях того или иного индикатора.
Взгляните на комплексный инструмент, расположенный ниже. Вы можете следить за появлением прибыльных сигналов в онлайн режиме.
Как видите, здесь присутствуют все стандартные таймфреймы от 5 минут до 1 месяца. Среди индикаторов есть как трендовые (к примеру, Alligator от Билла Вильямса, ADX), так и осцилляторы (RSI, Stochastic и т.д.).
Значения каждого сигнала можно проверить, нажав на надпись: «Покупать» или «Продавать» , в нужном временном интервале. Откроется реальный график с этим индикатором в режиме онлайн. Многие будут согласны, что это невероятно удобно, именно поэтому я выбрала этот сервис.
В целом система выглядит многообещающе. Тем не менее, трейдеры-новички очень часто совершают ошибку, пытаясь использовать все индикаторы и таймфреймы сразу. Иногда, сигналы противоречат друг другу, это их вводит в ступор, они начинают сомневаться в качестве сигналов. Чтобы этого избежать, необходимо всесторонне оценить рынок, выявив предпосылки трендового движения либо консолидации цен. Рассмотрим подробнее механику использования комплексного анализа при торговле бинарными опционами.
Шаг первый. Перед тем, как приступить к просмотру индикаторов, рекомендую открыть экономический календарь и оценить новостной фон в том инструменте, который планируете торговать. Это требуется, чтобы выяснить вероятность формирования сильного тренда внутри дня. Кроме того, волатильность на рынке может возрасти при нахождении цены у исторических экстремумов (максимумов и минимумов), либо сильных уровней поддержки и сопротивления. Многое зависит и от времени торгов. Сильные движения на высоких объемах чаще встречаются во время Европейской торговой сессии (с 11:00 до 19:00 МСК). Таким образом, первоочередная задача – понять рыночную ситуацию на текущий момент, есть ли предпосылки для сильного движения и т.д.
Шаг второй. Следующий шаг зависит от обстоятельств. Если есть новости, на рынке появился импульс (сильное краткосрочное движение), то необходимо применять трендовые сигналы. Лучше всего подойдут Alligator, ADX и SAR, а также менее известный AROON (его можно и исключить, достаточно 3). Alligator указывает на основное направление движения, когда все его линии пересечены в ту или иную сторону. Что касается ADX, то он оценивает силу тренда, а Parabolic SAR – показывает точку входа, если цена действительно растет или падает. В итоге, когда все четыре индикатора одновременно показывают – «Продавать» или «Покупать», следует входить в сделку в соответствующем направлении.
Альтернативы. Другая ситуация – рынок спокоен, новостей нет, исторических экстремумов (максимумов и минимумов) тоже. Внутри дня нет импульсов, возможно Вам удобнее торговать в течение Азиатской сессии (ночное время по МСК). В таком случае, всё складывается в пользу применения осцилляторов (RSI, CCI, MACD, Stochastic), при этом для страховки рекомендуется сверять показания ADX, лучше, чтобы он был в нейтральной зоне. Между делом скажу, что ADX – это невероятно полезный инструмент в любой ситуации, практически всегда, когда он ниже 25 на рынке флэт. Возвращаясь к торговле, получаем итог – если все 4 осциллятора показывают «Покупать» или «Продавать», а ADX – «Нейтрально», то входим в сделку.
Примечание. Важный вопрос – выбор таймфреймов. Многие слышали идею трех экранов Элдера, когда применяются сразу 3 временных интервала, на старшем оценивается тренд, на младших перекупленность или перепроданность осцилляторами. Теоретически это должно работать, но практически я бы рекомендовала сосредоточиться на одном интервале в зависимости от времени экспирации (сроков закрытия) опциона. К примеру, для опционов – 5, 15, 30 минут достаточно обратить внимание на М5 (от 1 до 6 свечей), для 60 минут хватает М15 (4 свечи). Если Вы будете «блуждать» по нескольким интервалам одновременно, то можете получить множество ложных сигналов и пропустить верные. Я сама сталкивалась с такой проблемой, поэтому советую сразу учиться еще и на чужих ошибках.
Пример первый. Для углубленного понимания вышеизложенной концепции использования комплексного анализа индикаторов через специализированный сервис, я разберу теорию на конкретной ситуации. В качестве примера возьмем самую популярную валютную пару – EURUSD. Рассмотрим недавнюю ситуацию – 15 декабря 2020 года. Я отобрала для Вас только свежие сделки (на момент написания статьи), потому что рынок постоянно меняется. Мне, например, было тяжело изучать информацию по древним графикам.
Мы видим, что по Еврозоне был сильный новостной фон, выходили данные по индексу деловой активности, а также в США индекс потребительских цен, информация по безработице, а за день до этого повышение процентной ставки. Иными словами, новостей много и все они значимые. Не стоит пытаться определить куда пойдет рынок по новостям, реакция бывает неоднозначной, мы лишь констатируем, что в этот день будет повышенный интерес у участников рынка.
Плюс, евро находится у годового минимума (пробит уровень 1.04624 – экстремум 3 декабря 2020 года), что говорит о вероятности повышенной волатильности внутри дня из-за скопления стоп-ордеров в этой зоне.
Теперь взглянем на индикаторы. Так как мы ориентируемся на тренд, то применим трендовую схему: ADX должен быть больше 25, Линии Alligator’а пересечены вниз, Parabolic SAR направлен вниз.
Как видите, на изображении отмечены зоны, когда индикаторы в сервисе показывали сигнал «Продавать» . Стоит отметить, что SAR довольно хорошо фильтрует сигналы предыдущих двух индикаторов, поэтому не стоит входить в сделку, когда он не дает сигналов. 15 декабря можно было достойно обогатиться, смотря за индикаторами на М5 и покупая опционы вниз с экспирацией от 5 до 30 минут.
Вышеуказанная система торговли даёт редкие, но более точные рекомендации для входа в позицию. Иногда, трендовые движения будут возникать и при полном затишье на рынке. В действительности можно использовать индикаторы в меньшей комплектации, получая большее количество сигналов, но тогда и процент прибыльных сделок значительно понизится.
Пример второй . Рассмотрим случай, когда на рынке была консолидация (флэт). Как раз за день до предыдущей ситуации – 14 декабря, было «затишье перед бурей». Все инвесторы ждали решения по процентной ставке в США, и никто толком не торговал. В результате цена весь день была в коридоре.
Рассмотрим осцилляторы из сервиса и их значения, а также ADX. Зеленым отмечены зоны, когда все индикаторы указывали на покупки или продажи. В итоге, даже в такой вялый день можно было прилично заработать. Стоит отметить, что MACD иногда даёт противоречивую информацию на фоне других индикаторов, его периодически можно исключать из схемы.
При должном опыте использования вышеуказанных стратегий, вероятность прибыльной сделки может достигать 80-90%. Более того, в этом направлении возможно абсолютно неограниченное развитие. Некоторые индикаторы можно исключать, другие добавлять и так далее. Рассматривать больше условий для формирования трендов, добавлять фильтры, применить технический анализ и построить канал для торговли.
Резюме технических индикаторов
Сейчас распишу Вам ещё один вариант использования технических индикаторов на валютные пары, он немного проще.
Вы можете следить за появлением прибыльных сигналов прямо здесь в онлайн режиме. Ведь специально для Вас я интегрировала таблицу с техническим анализом на свой сайт, и она работает в режиме реального времени. Время указано в таблицах по GMT.
А теперь давайте разберёмся в стратегии торговли валютными парами, как правильно анализировать данные индикаторы. Если Вы видите, что напротив определённой пары имеется надпись «Активно покупать» во всех временных отрезках (5 минут, 15 минут, Часовой, Дневной), это означает, что прогноз изменения стоимости актива стабильный. В ближайшее время эта тенденция сохранится, и цена пары будет продолжать расти. Поэтому стоит покупать опцион на повышение на ближайшие 15-30 минут минут.
Если же Вы видите, что напротив определённой пары имеется надпись «Активно продавать» во всех временных отрезках (5 минут, 15 минут, Часовой, Дневной), это означает, что прогноз изменения стоимости актива также максимально сильный. В ближайшее время эта тенденция сохранится, и цена пары будет продолжать падать. Поэтому стоит покупать опцион на понижение на ближайшие 15-30 минут.
Если в таблице напротив валютной пары по разным временным отрезкам имеются разные сигналы к действию, опцион ни в коем случае не открывайте. Сигнал будет слабым и противоречивым.
Дополнительно Вы можете ориентироваться на сделки других трейдеров, какое направление они выбирают для валютных пар. Если процент выбора более 75%, то подсказкой можно пользоваться.
Советую вам ознакомиться также со Стратегией торговли бинарными опционами по Торговым сигналам. Там Вы найдёте руководство по использованию сигналов при трейдинге индексами, сырьевыми товарами и акциями.
Хочу обратить Ваше внимание, что стоимость валютных пар очень подвержена различным экономическим новостям. Поэтому открывая опцион, убедитесь, что в ближайшие 30 минут не намечается выход новостей. Более подробно со Стратегией торговли по новостям экономического календаря Вы можете ознакомиться, перейдя по ссылке. Там можно найти и сам календарь в онлайн режиме. А все предсказания по валютным парам, основываясь на экономический календарь можно найти в рубрике Новости.
Ещё больше способов торговли по валютным парам описаны в статье Стратегии торговли бинарными опционами (полный список).
Сигналы forex/cfd
Хотите начинать зарабатывать с самого начала карьеры трейдера? Предоставляю вашему вниманию лучшие бесплатные сигналы для трейдеров бинарных опционов! Это не «гарантированный заработок» (в нашем деле такого просто не может быть), но прекрасная возможность научиться трейдингу, работая с простыми и надежными алгоритмами.
Пользоваться роботами для форекс/бинарных опционов – это совершенно нормально: ведь активно работающий трейдер не будет успевать совершать все нужные расчеты. Но какие роботы лучше выбирать? Ознакомьтесь с моим личным рейтингом роботов, основанном на личном опыте торговли!
Binary Options Robot Abi – одна из лучших программ для помощи трейдерам бинарных опционов. Я сама активно пользуюсь «услугами» этого помощника, которому можно поручить практически всю рутинную работу, связанную с расчетами. В итоге вы можете сосредоточиться на аналитике – и преуспеть в заключении сделок!
Относительно новый, но уже популярный робот для бинарных опционов. По моему мнению, это лучший из новых программных продуктов на трейдерском рынке, поэтому смело могу рекомендовать его своим читателям. Узнайте о преимуществах робота TradersBuddy, прочитав статью!
Не устраивают стандартные роботы бинарных опционов? Создайте свой робот и полностью настройте его под себя. Сервис IQ Robots (от IQ Option) позволит любому пользователю создать собственную программу для помощи в заключении сделок – и пользоваться всеми преимуществами, которое она даёт!
Хорошую программу не грех и прорекламировать – но этот материал я хочу посвятить антирекламе. Со всей уверенностью утверждаю, что робот для бинарных опционов “Элли” – совершенно бесполезный “помощник”, использовать которого не рекомендую никому и никогда.
Как выбрать самого надежного торгового робота? Представляю вам собственный рейтинг, где сообщаю, какие программы являются самыми эффективными, какие – самыми простыми, какие – самыми удобными. Я лично пользовалась всеми программами, которые анализирую, и готова отвечать за все свои характеристики!
Почему торговые сигнальные системы так популярны? Почему торговать с их помощью лучше, чем “вживую”? Какие помощники являются самыми надежными? В этой статье я резюмирую всё написанное мной о роботах бинарных опционов и доступно объясняю, почему рекомендую пользоваться их помощью.
Копирование сделок трейдеров – это, вопреки стереотипам, не самая простая работа. В этом материале я описываю, какими способами можно и нужно копировать сделки, если вы рассчитываете на стабильные и солидные выигрыши. Для достоверности привожу наглядные примеры – с графиками и чертежами.
В какой момент нужно заключать сделку, чтобы шансы на успех были наибольшими? Это помогут решить эффективные инструменты – индикаторы бинарных опционов. Вкратце рассказываю о тридцати самых популярных индикаторах и привожу подробные ссылки на их описания.
Страница 1 из 4
Раздел Сигналы forex/cfd/бинарных опционов познакомит Вас с различными способами получения торговых сигналов для forex/cfd/бинарных опционов бесплатно для успешной торговли. Они Вам пригодятся, если Вы только пришли на финансовый рынок и пока не нашли подходящей для себя стратегии, или если желаете увеличить свой депозит, следуя советам и подсказкам опытных трейдеров, их онлайн сигналам.
На выбор предоставляются:
- бесплатные торговые сигналы для forex/cfd/Бинарных Опционов;
- индикаторы для бинарных опционов по валютным парам, акциям, индексам и сырьевым товарам;
- платные программы , которые в автоматическом режиме посылают сигналы после комплексного анализа рынка;
- список брокеров forex/cfd/бинарных опционов , предоставляющих своим клиентам сигналы для успешной торговли.
Я уверена, что Вы найдёте подходящий для себя способ получения лучших, надёжных и прибыльных сигналов! Ведь сотни трейдеров ищут бесплатные, торговые сигналы в живую онлайн.
Стоит ли использовать сигналы для forex/cfd/бинарных опционов?
Первое, что приходит на ум о сигналах – это один из хороших моментов моей карьеры, который очень сильно помог на первых порах. По сути, я сравнивала свои наработки и стратегии с полученными рекомендациями по входам в сделки, и такая схема работы вывела мои навыки на совершенно новый уровень.
Сейчас есть отличные как платные, так и бесплатные сервисы в зависимости от Ваших возможностей. Всё это на руку для начинающих трейдеров опционами, и позволит избежать убытков на счёте. Плюс, поддерживает психологически, когда Ваши домыслы совпадают с получаемыми советами.
Как правило, все сигналы основаны на применении технического анализа (фундаментальный больше используется в аналитике). Где-то используются индикаторы, где-то автор вручную даёт рекомендации. Я сама когда-то была в подобной ситуации, и если Вы начинающий трейдер, то желательно не просто копировать сделки, а пытаться понять почему был дан сигнал.
Для чего это нужно? На рынке постоянная конкуренция, и он в любой момент может начать вести себя иначе. Когда Вы понимаете смысл сигналов, а также на чем они основаны, то сможете легко подстроиться под ситуацию, либо начать торговать самостоятельно.
Торговые сигналы для forex/cfd/опционов – это мощный инструмент в развитии, а также «подушка безопасности» для начинающего трейдера. Они нужны, чтобы совершенствовать свою торговлю, находить какие-то новые идеи, иметь психологическую поддержку и подтверждение собственных сделок. Удачного Вам профита, друзья!